LL-37 5mg  Premium Antimicrobial Peptide for Research & Scientific Study

LL-37 5mg is a cutting-edge antimicrobial peptide (AMP) widely studied for its potent immunomodulatory, anti-inflammatory, and wound-healing properties. As the only known member of the human cathelicidin family, LL-37 plays a fundamental role in the body’s innate immune defense system. This high-purity research-grade peptide is designed exclusively for in vitro and in vivo scientific investigations, offering researchers a reliable and consistent compound for exploring its diverse biological mechanisms.

What Is LL-37 Peptide? An Overview of Its Biological Role

LL-37 is a 37-amino acid cationic peptide derived from the C-terminal end of the human cathelicidin protein hCAP18. It is expressed in neutrophils, epithelial cells, macrophages, and NK cells, and is rapidly released in response to infection and inflammation. LL-37 interacts with bacterial membranes, disrupting their integrity and neutralizing endotoxins, making it a subject of intense research interest in immunology, microbiology, and regenerative medicine.

Key Biochemical Properties of LL-37

• Molecular Formula: C205H340N60O53S
• Molecular Weight: Approximately 4,493.3 Da
• Purity: ≥95% (HPLC verified)
• Sequence: [LL-37, 37 aa]
• Appearance: Lyophilized white to off-white powder
• Solubility: Soluble in water or dilute acetic acid

LL-37 5mg Research Applications: What Scientists Are Discovering

LL-37 has emerged as one of the most studied antimicrobial peptides due to its multifaceted biological activity. Below are the key research areas where LL-37 5mg is actively being investigated:

1. Antimicrobial and Antibiofilm Activity

LL-37 demonstrates broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria, fungi, and enveloped viruses. Research has shown that it disrupts microbial membrane integrity through electrostatic interaction, leading to cell lysis. It also exhibits significant antibiofilm properties, inhibiting and degrading established biofilms — a key area of study for combating antibiotic-resistant infections and chronic wound management.

2. Wound Healing and Tissue Regeneration

Studies examining LL-37 in wound healing models have revealed its ability to promote cell migration, proliferation, and angiogenesis. By binding to formyl peptide receptor-like 1 (FPRL1) and epidermal growth factor receptor (EGFR), LL-37 activates downstream signaling pathways that accelerate keratinocyte migration and re-epithelialization. These properties make it a compelling candidate for research in chronic wound treatment and diabetic ulcer healing.

3. Immunomodulation and Anti-inflammatory Research

Beyond direct antimicrobial effects, LL-37 plays a sophisticated immunomodulatory role. It modulates toll-like receptor (TLR) signaling, influences cytokine production, and recruits immune cells to infection sites. Research models have explored its potential in autoimmune and inflammatory conditions, including psoriasis, lupus, and rosacea, where dysregulated LL-37 expression has been observed. These studies position LL-37 as an important tool in understanding host-defense peptide biology.

LL-37 5mg Product Specifications and Storage Guidelines

Our LL-37 5mg is manufactured under strict quality control standards to ensure reproducibility and reliability in all research applications. Each lot is tested for purity, identity, and biological activity before release.

Specifications at a Glance

• Quantity: 5mg per vial
• Form: Lyophilized powder
• Purity: ≥95% by HPLC
• Storage: −20°C, avoid repeated freeze-thaw cycles
• Stability: 24 months when stored correctly
• Reconstitution: Sterile water or 0.1% acetic acid recommended
• Research Use Only: Not for human or veterinary use

Why Choose Our LL-37 5mg for Your Research Laboratory

Selecting the right research-grade peptide is critical to obtaining valid, reproducible results. Our LL-37 5mg stands apart for the following reasons:

• High purity guaranteed: Every batch undergoes rigorous HPLC and mass spectrometry analysis.
• Consistent lot-to-lot quality: Manufactured under GMP-aligned peptide synthesis protocols.
• Certificate of Analysis (CoA) provided: Full documentation for every shipment.
• Secure cold-chain shipping: Ensuring peptide integrity from production to your lab.
• Expert research support: Our scientific team is available to assist with reconstitution and experimental design queries.

Important Notice: Research Use Only

LL-37 5mg is strictly intended for in vitro laboratory research and pre-clinical studies. It is not approved for human or animal therapeutic use, and it must not be used as a drug, food additive, or household chemical. All purchasing researchers are responsible for complying with applicable local regulations and institutional review requirements governing the use of research peptides.

Order LL-37 5mg today and advance your antimicrobial peptide research with a compound trusted by leading laboratories worldwide